Recombinant Human SLC27A1, N-His
Name : Recombinant Human SLC27A1, N-His
Background :
Background :
Biological Activity :
Species :
Human
Expression System :
Protein Accession :
Q6PCB7
Synonyms :
Recombinant Human SLC27A1, N-His
Amino Acid Sequence :
Molecular Weight :
40.30 kDa
Purity :
>90% as determined by SDS-PAGE.
Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.
Endotoxin Level :
Please contact with the lab for this information.
Construction :
A DNA sequence encoding the Human SLC27A1(Gln280-Phe619) was fused with the N-His Tag.
Formulation :
0.01M PBS, pH 7.4, 0.02% NLS
Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
83-46-5 MedChemExpress 1115-70-4 Biological Activity PMID:30726029 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Recombinant Human NAD-dependent protein deacetylase sirtuin-6(SIRT6)
Product Name :
Recombinant Human NAD-dependent protein deacetylase sirtuin-6(SIRT6)
Brief Description :
Recombinant Protein
Accession No. :
Q8N6T7
Calculated MW :
66 kDa
Target Sequence :
SVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLEPKEESPTRINGSIPAGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKRVKAKAVPS
Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
Application Details :
Uniprot :
Q8N6T7
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
CRTC2 Antibody Technical Information Cidofovir Autophagy PMID:34962099 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Recombinant Human SPARCL1, N-GST
Name : Recombinant Human SPARCL1, N-GST
Background :
Background :
Biological Activity :
Species :
Human
Expression System :
Protein Accession :
Q14515
Synonyms :
Recombinant Human SPARCL1, N-GST
Amino Acid Sequence :
Molecular Weight :
54.44 kDa
Purity :
>90% as determined by SDS-PAGE.
Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.
Endotoxin Level :
Please contact with the lab for this information.
Construction :
A DNA sequence encoding the Human SPARCL1(Gly298-His545) was fused with the N-GST Tag.
Formulation :
0.01M PBS, pH 7.4, 0.02% NLS
Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
1448347-49-6 medchemexpress 58-14-0 manufacturer PMID:25905253 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Recombinant rat Insulin-like growth factor I
Product Name :
Recombinant rat Insulin-like growth factor I
Brief Description :
Recombinant Protein
Accession No. :
P08025
Calculated MW :
34.7 kDa
Target Sequence :
GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA
Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
Application Details :
Uniprot :
P08025
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Alclometasone dipropionate (Standard) Biological Activity ALDH1L1 Antibody supplier PMID:35198617 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Recombinant Human PLD1, N-His
Name : Recombinant Human PLD1, N-His
Background :
Background :
Biological Activity :
Species :
Human
Expression System :
Protein Accession :
Q13393
Synonyms :
Recombinant Human PLD1, N-His
Amino Acid Sequence :
Molecular Weight :
42.04 kDa
Purity :
>90% as determined by SDS-PAGE.
Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.
Endotoxin Level :
Please contact with the lab for this information.
Construction :
A DNA sequence encoding the Human PLD1(Thr725-Thr1074) was fused with the N-His Tag.
Formulation :
0.01M PBS, pH 7.4, 0.02% NLS
Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
163042-96-4 Synonym 157-03-9 medchemexpress PMID:30844191 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Recombinant human Ferritin heavy chain
Product Name :
Recombinant human Ferritin heavy chain
Brief Description :
Recombinant Protein
Accession No. :
P02794
Calculated MW :
48.1 kDa
Target Sequence :
TTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSDNES
Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
Application Details :
Uniprot :
P02794
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Tiotropium web SESN2 Antibody medchemexpress PMID:34773274 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Recombinant Human TAGLN, N-His
Name : Recombinant Human TAGLN, N-His
Background :
Background :
Biological Activity :
Species :
Human
Expression System :
Protein Accession :
Q01995
Synonyms :
Recombinant Human TAGLN, N-His
Amino Acid Sequence :
Molecular Weight :
24.92 kDa
Purity :
>90% as determined by SDS-PAGE.
Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.
Endotoxin Level :
Please contact with the lab for this information.
Construction :
A DNA sequence encoding the Human TAGLN(Met1-Ser201) was fused with the N-His Tag.
Formulation :
0.01M PBS, pH 7.4, 0.02% NLS
Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
3056-17-5 web 50-35-1 Biological Activity PMID:28125198 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Recombinant Human WNT3A, N-His
Name : Recombinant Human WNT3A, N-His
Background :
Background :
Biological Activity :
Species :
Human
Expression System :
Protein Accession :
P56704
Synonyms :
Recombinant Human WNT3A, N-His
Amino Acid Sequence :
Molecular Weight :
39.75 kDa
Purity :
>90% as determined by SDS-PAGE.
Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.
Endotoxin Level :
Please contact with the lab for this information.
Construction :
A DNA sequence encoding the Human WNT3A(Ser19-Lys352) was fused with the N-His Tag.
Formulation :
0.01M PBS, pH 7.4, 0.02% NLS
Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
147127-20-6 MedChemExpress 133855-98-8 manufacturer PMID:30725737 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Recombinant human Sex comb on midleg-like protein 4
Product Name :
Recombinant human Sex comb on midleg-like protein 4
Brief Description :
Recombinant Protein
Accession No. :
Q8N228
Calculated MW :
49 kDa
Target Sequence :
MPCQRTAWIGCDRQRTPPFHWREIKSRVLMTPLALSPPRSTPEPDLSSIPQDAATVPSLAAPQALTVCLYINKQANAGPYLERKKVQQLPEHFGPERPSAVLQQAVQACIDCAHQQKLVFSLVKQGYGGEMVSVSASFDGKQHLRSLPVVNSIGYVLRFLAKLCRSLLCDDLFSHQPFPRGCSASEKVQEKEEGRMESVKTVTTEEYLVNPVGMNRYSVDTSASTFNHRGSLHPSSSLYCKRQNSGDSHLGGGPAATAGGPRTSPMSSGGPSAPGLRPPASSPKRNTTSLEGNRCGNVMHASASH
Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
Application Details :
Uniprot :
Q8N228
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
NEDD4 Antibody Protocol S100A4 Antibody Purity PMID:35239671 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Recombinant Human HMGA2, N-His
Name : Recombinant Human HMGA2, N-His
Background :
Background :
Biological Activity :
Species :
Human
Expression System :
Protein Accession :
P52926
Synonyms :
Recombinant Human HMGA2, N-His
Amino Acid Sequence :
Molecular Weight :
14.14 kDa
Purity :
>90% as determined by SDS-PAGE.
Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.
Endotoxin Level :
Please contact with the lab for this information.
Construction :
A DNA sequence encoding the Human HMGA2(Met1-Asp109) was fused with the N-His Tag.
Formulation :
0.01M PBS, pH 7.4, 0.02% NLS
Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
148893-10-1 Biological Activity 210302-17-3 References PMID:29083755 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com