Scgb1a1 (Rat) Recombinant Protein

Name :
Scgb1a1 (Rat) Recombinant Protein

Biological Activity :
Rat Scgb1a1 (P17559) recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins

Tag :

Protein Accession No. :
P17559

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=25575

Amino Acid Sequence :
SSDICPGFLQVLEALLLGSESNYEAALKPFNPASDLQNAGTQLKRLVDTLPQETRINIVKLTEKILTSPLCEQDLRV

Molecular Weight :
17

Storage and Stability :
Store, frozen at -20°C for longer periods of time.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.

Host :
Escherichia coli

Interspecies Antigen Sequence :

Preparation Method :
Escherichia coli expression system

Purification :

Quality Control Testing :

Storage Buffer :
Lyophilized from PBS, pH 7.4.

Applications :
Functional Study, SDS-PAGE,

Gene Name :
Scgb1a1

Gene Alias :
CC10, CCSP, PCBB, Ugb

Gene Description :
secretoglobin, family 1A, member 1 (uteroglobin)

Gene Summary :
family 1A

Other Designations :
Uteroglobin (Clara cell secretory protein)|secretoglobin family 1A member 1

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Cathepsin D Proteinmedchemexpress
IL-7 Proteinweb
Popular categories:
Immunoglobulin Superfamily Member 11 (IGSF11)
CD40