Name :
AKR1C3 (Human) Recombinant Protein

Biological Activity :
Human AKR1C3 (NP_003730, 1 a.a. – 323 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins,Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength

Tag :

Protein Accession No. :
NP_003730

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=8644

Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHMDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY

Molecular Weight :
39

Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.

Host :
Escherichia coli

Interspecies Antigen Sequence :

Preparation Method :
Escherichia coli expression system

Purification :
Conventional Chromatography

Quality Control Testing :
Loading 3 ug protein in 15% SDS-PAGE

Storage Buffer :
In 20 mM Tris-HCl buffer, pH 8.0 (10% glycerol).

Applications :
Functional Study, SDS-PAGE,

Gene Name :
AKR1C3

Gene Alias :
DD3, DDX, HA1753, HAKRB, HAKRe, HSD17B5, KIAA0119, hluPGFS

Gene Description :
aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II)

Gene Summary :
This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reduction of prostaglandin (PG) D2, PGH2 and phenanthrenequinone (PQ), and the oxidation of 9alpha,11beta-PGF2 to PGD2. It may play an important role in the pathogenesis of allergic diseases such as asthma, and may also have a role in controlling cell growth and/or differentiation. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. [provided by RefSeq

Other Designations :
OTTHUMP00000018996|aldo-keto reductase family 1, member C3|chlordecone reductase|dihydrodiol dehydrogenase 3|dihydrodiol dehydrogenase X|hydroxysteroid (17-beta) dehydrogenase 5|prostaglandin F synthase|trans-1,2-dihydrobenzene-1,2-diol dehydrogenase|type

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-12 Recombinant Proteins
Hemopexin Proteinmanufacturer
Popular categories:
Carbonic Anhydrase 13 (CA-XIII)
Cadherin-19